PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07583A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 442aa    MW: 50685.2 Da    PI: 7.129
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07583AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-121555445
                               S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                               W ++E+ ll+++++++G g+W+ +a+++g ++t  qc++++ 
  Oropetium_20150105_07583A 15 WNADEEILLLEGIEMYGLGNWAEVAEHVG-TKTKAQCIEHYT 55
                               *****************************.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.79E-13861IPR009057Homeodomain-like
PROSITE profilePS5129322.7951062IPR017884SANT domain
SMARTSM007172.2E-111160IPR001005SANT/Myb domain
PfamPF002492.7E-121455IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-91557IPR009057Homeodomain-like
CDDcd001671.94E-111556No hitNo description
SuperFamilySSF466893.94E-14372430IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MQQDNLSFPL ICPDWNADEE ILLLEGIEMY GLGNWAEVAE HVGTKTKAQC IEHYTTAYMN  60
SPCYPLPDMS RVSGKNRKEL LAMAKVQGES KKGTSLLPGD LTPKAESPFS PSRVKLEDAL  120
GEGPAGRSPS HIASGANKKA SNIGHMKDGP NVSKVEDGHV DRSIGVKKPR YSAEDGPSLT  180
ELSGYNAKRH EFDPEYDNDA EQALAEMEFK ETDSETDREL KLRVLRIYLS RLDERKRRKE  240
FILERNLLFP NPLEKDLTNE DKEVYHRYKV FMRFLSKEEH EALVRSVLEE RKIRRRIQEL  300
QECRSAGCRT LAEAKIHIEQ KRKKEYELNA QKAKEXXXXX XXXXXXXXXX XXXXXXXXXX  360
XXPKKESSIL LFQEKLLCCQ NRLLPSHYLR MQEMLMQEIF KGSVLKKEDA HVLFKVDPAK  420
VDTVYDMVMK KLGNHEEVPA V*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1234239RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105146.10.0histone acetyltransferase complex component102
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLQ8S9F80.0Q8S9F8_MAIZE; Transcriptional adaptor
STRINGGRMZM2G177974_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77083847